PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041159.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 638aa    MW: 71090.2 Da    PI: 4.3734
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041159.3genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.33.1e-5391361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtdeelv++yLk+kv+gk++++ + i+ vdiyk+ePwdLp k k+k+++ ewyfFs  dkky +++r+nrat++gyWk+tgkd++v++ +
  Pbr041159.3   9 LAPGFRFHPTDEELVWYYLKRKVSGKNFRF-DPISVVDIYKIEPWDLPgKsKLKTRDLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKDRPVKH-N 104
                  579**************************9.99***************5347777888**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kktLvf++grap+g +t+Wvmheyrl
  Pbr041159.3 105 SRDVGMKKTLVFHSGRAPTGARTNWVMHEYRL 136
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-576146IPR003441NAC domain
PROSITE profilePS5100555.0669190IPR003441NAC domain
PfamPF023657.4E-2811136IPR003441NAC domain
SuperFamilySSF1019412.88E-57178190IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MARGKENSLA PGFRFHPTDE ELVWYYLKRK VSGKNFRFDP ISVVDIYKIE PWDLPGKSKL  60
KTRDLEWYFF SFLDKKYGNS SRTNRATEKG YWKTTGKDRP VKHNSRDVGM KKTLVFHSGR  120
APTGARTNWV MHEYRLSNEE LEKAGIQQVW IFVDVAIVLL AFYDIGIDCW VCCGGWVQKD  180
PYVLCRIFQK SGTGPKNGEK YGAPVMEEEW DDDDVTGVPG EEAAANVVVL SEEPHVEAIG  240
VNDGAYVEAF DLDQNLDTGI PSESAPPPSN FYYGETSHYF EHSGDFVEDD TKAVIGTGET  300
SEYCGDQMFF NYPEHHETVG NPVKNEYMTS QSPEDLKFVD LPEHNEADAK SVKDECFLEP  360
SDDANPAVVN YSLNEPYLNA TENTPIGDGL FLEANDLSNP VESTAGFDML DEYLTYFDAN  420
DDISQYIDFD SCGMMGVENY VPDEAPADQK LVNGETEPQP MGGEHVQPEP QPMGGEHLVQ  480
PVDTDDASSS KKMAEFKFES DGNYPFIKKA SHMMLGSIPA PPAFASEFPG KEAMRRLNSG  540
AASSSSVHVT AGMIRIRDIT SSDNRMDWSF GKDGVVNLVF SVQLPQNDGN SGNLVPVGGS  600
LSGKTGCVVM RGWFLFMFFW VLFLSMSLKI GSYIYTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-44613612140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346651.10.0PREDICTED: NAC domain-containing protein 78-like isoform X2
TrEMBLD9ZJA80.0D9ZJA8_MALDO; NAC domain class transcription factor
STRINGVIT_13s0019g05240.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-146NAC domain containing protein 2